PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000205938
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 248aa    MW: 28364.6 Da    PI: 6.1212
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000205938genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.69.1e-4841351128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                    lppG+rF Pt+eelv++yL++k++gk+ ++ +vi+ vdiy+ ePwdLpk     +++++++w+fF++r++++a+g r+nr+t+sgyWkatg+   v
  MDP0000205938   4 LPPGYRFYPTEEELVSFYLQNKLQGKREDTRRVIPIVDIYSKEPWDLPKlsgeLCRGDKEQWFFFTRRQQREAQGGRPNRTTASGYWKATGSPGYV 99 
                    79****************************99****************656654445777************************************ PP

            NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +s++++++g+kkt+vfykg+ap+g+kt+W m+eyr+
  MDP0000205938 100 YSSENKVIGVKKTMVFYKGKAPTGRKTKWKMNEYRA 135
                    **********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-503159IPR003441NAC domain
PROSITE profilePS5100550.064160IPR003441NAC domain
PfamPF023654.8E-255134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MEELPPGYRF YPTEEELVSF YLQNKLQGKR EDTRRVIPIV DIYSKEPWDL PKLSGELCRG  60
DKEQWFFFTR RQQREAQGGR PNRTTASGYW KATGSPGYVY SSENKVIGVK KTMVFYKGKA  120
PTGRKTKWKM NEYRAIEVDD STTNTPKLGH EFRLCRVYVV SGSSRAFDRR PLEPVGEAQQ  180
KFSDSTGAST SSLKTTMVEK ASSSDETYSN SGELGDLPET SAGINSSNWE INEGFEEPLW  240
EWEQLNFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-36415817163NAC domain-containing protein 19
4dul_A2e-36415817163NAC domain-containing protein 19
1ut7_B2e-36415817163NO APICAL MERISTEM PROTEIN
1ut7_A2e-36415817163NO APICAL MERISTEM PROTEIN
1ut4_B2e-36415817163NO APICAL MERISTEM PROTEIN
1ut4_A2e-36415817163NO APICAL MERISTEM PROTEIN
3swp_D3e-36416520173NAC domain-containing protein 19
3swp_C3e-36416520173NAC domain-containing protein 19
3swp_B3e-36416520173NAC domain-containing protein 19
3swp_A3e-36416520173NAC domain-containing protein 19
3swm_D3e-36416520173NAC domain-containing protein 19
3swm_C3e-36416520173NAC domain-containing protein 19
3swm_B3e-36416520173NAC domain-containing protein 19
3swm_A3e-36416520173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008391138.10.0PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR33e-92NAC90_ARATH; NAC domain-containing protein 90
TrEMBLM5WHE71e-146M5WHE7_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s22630.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-93NAC domain containing protein 90